CAD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products
Product Details
DayTripper - 1 1/4 84mm - cone filling machine
DayTripper - 1 1/4 84mm - cone filling machine
Brand:Party Roller
Product Code:daytripper
weight:2.0kg
Product Condition:New
$111.87 inc. tax
$99.00 ex. tax
? Tax based on Ontario, Canada.
Add to Cart
Description
Ships from our Canadian warehouse All out of country sales taxes will be charged by Customs, not by PartyRoller.

Introducing The DayTripper: Your Ultimate Cone-Filling Companion!

Get ready to elevate your rolling game with The DayTripper, your go-to solution for seamless cone filling. Whether you're a seasoned roller or just starting out, The DayTripper has you covered with its versatile features and precision engineering.

Rolling papers, pre-rolled cones, and joint rolling accessories—The DayTripper accommodates them all, making it a must-have for every rolling enthusiast. With its innovative rolling techniques and joint packing tool, you'll be rolling perfect cones in no time.

Choose from a variety of rolling paper brands, including hemp, organic, king size, slim, flavored, and custom options, to suit your preferences. The DayTripper also offers convenient rolling paper storage, keeping your supplies organized and within reach.

But that's not all—The DayTripper is also compatible with hydroponic equipment, grow room essentials, and smoking accessories wholesale. Whether you're in the cannabis industry or a hobbyist, The DayTripper is your trusted companion for all your rolling and cultivation needs.

From dispensary display solutions to packaging for edibles, The DayTripper caters to every aspect of the cannabis retail experience. With its commitment to quality and innovation, The DayTripper sets the standard for excellence in the industry.

Experience the convenience and efficiency of The DayTripper today and take your rolling game to new heights. Join the revolution in cone filling and discover why The DayTripper is the ultimate choice for rollers everywhere.

Keep your DayTripper pristine by cleaning it with hot water up to 130º F. Avoid warping by refraining from dishwasher use. We recommend an isopropyl (rubbing alcohol) and salt mixture for effective resin removal.

Please note, our products undergo 3D printing, you may experience visual defects and layer lines. Expect a lead time of 3-7 days before shipping, given the custom crafting process. Limited stock available. Thank you for choosing our custom 3D printed items. Colors will vary. 


Keywords:

Rolling papers,Joint rolling tips,Pre-rolled cones,Rolling techniques,Best rolling papers,Joint rolling accessories,Rolling tray,Rolling machine,Joint roller,Rolling paper brands,Hemp rolling papers,Organic rolling papers,King size rolling papers,Slim rolling papers,Flavored rolling papers,Custom rolling papers,Joint packing tool,Cone filler,Rolling paper storage,Tips for rolling a perfect joint,Hydroponic Equipment,Grow Room Essentials,Smoking Accessories Wholesale,Cannabis Cultivation Tools,Weed Dispensary Packaging,Vape Pen Accessories,CBD Product Packaging,Cannabis Industry Wholesale,Dispensary Display Solutions,Marijuana Business Supplies,Extraction Equipment,Rolling Papers Wholesale,Cannabis Storage Solutions,Packaging for Edibles,Cannabis Retail Essentials,Smoking Paraphernalia Wholesale,Cannabis Labeling and Branding,Terpene Extraction Tools.

 

Never fuss over who or when you'll have time to roll a joint! Use the DayTripper and create your own pack.
 

Is This the Ultimate Cone Filling Solution?

Are you tired of spending precious time meticulously filling cones by hand, only to end up with uneven packs and wasted materials? Say hello to the DayTripper – a revolutionary cone filling machine designed to streamline your rolling process and elevate your smoking experience to new heights.

Efficiency Redefined

Imagine being able to fill up to 25 cones in one seamless session with the DayTripper. No more tedious manual labor or guesswork involved. With its 84mm Cone Rocking Machine, the DayTripper is engineered to accommodate various cone sizes, from 84mm to 1¼ size cones, making it versatile enough to meet your smoking preferences.

The Ultimate Question: Is the DayTripper Worth It?

Now, you may be wondering – is the DayTripper truly worth the investment? Consider this: the DayTripper not only saves you time and effort but also ensures consistent, evenly packed cones with every use. Its user-friendly design and precision engineering make it a must-have accessory for both novice enthusiasts and seasoned smokers alike.

Conclusion: Elevate Your Rolling Experience with the DayTripper

In conclusion, if you're ready to take your rolling game to the next level and experience the convenience and precision of a top-of-the-line cone filling machine, the DayTripper is your answer. Say goodbye to uneven packs and wasted materials – and hello to effortless, perfectly filled cones every time. Are you ready to revolutionize your rolling experience with the DayTripper?

Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review


LIMITED STOCK!! PRODUCT KICK STARTER! This Item is 3D printed for each order! Please allow 3-5 Days before the Item ships. Colors vary depending on supplies. Ships from our Canadian warehouse, All out of country sales taxes and customs will be charged by Customs, not by PartyRoller.

Introducing the PartyRoller, StubbyBuddy and KingRoller: Your Ultimate Industrial Cone Filler!

Prepare to revolutionize your cone-filling process with the PartyRoller, the ultimate industrial cone filler designed for maximum efficiency. With the PartyRoller, you can effortlessly make 100 cones in no time, streamlining your production like never before.

With each size of PartyRoller you get the PartyPoker and the PartySifter. Say goodbye to time-consuming processes and hello to seamless cone filling with the PartyRoller!

Description:
Changes color depending on what angle you look at it!

Experience unparalleled cone-filling efficiency with our Cone Filling Machine Starter Kit, capable of filling up to 100 cones in a single session.  This kit is your ticket to hassle-free cone filling.

How to Party Roll:

Load 100 of your preferred cones into the designated slots. Dispense 60g of material into the PartySifter and sift out unwanted stems. Then use the PartyPoker to firmly pack the material into the cones. Apply an additional 40-50g of material and pack again for optimal density. Feel free to bounce it off your work table to even out the material. Remove the rubber base to release the cones with a simple twist, and you're ready to rock the party!

3 sizes: KingRoller 98-110mm, PartyRoller 85mm and the StubbyBuddy 53-60mm.

Check our website www.Partyroller.com for Accessories 

The PartyRoller is easily cleaned with hot water up to 130º F, but avoid using a dishwasher to prevent warping. For effective residue removal, we recommend using an isopropyl (rubbing alcohol) and salt mixture. Please keep the PartyRoller away from temperatures exceeding 130º and direct sunlight exposure for optimal longevity.

Product Added to your Cart
x

-------- OR --------